DIRC2 anticorps (Middle Region)

N° du produit ABIN635117

L’anticorps Lapin Polyclonal anti-DIRC2 a été validé pour WB. Il convient pour détecter DIRC2 dans des échantillons de Humain et Souris.

Aperçu rapide pour DIRC2 anticorps (Middle Region) (ABIN635117)

Antigène: DIRC2 (Disrupted in Renal Carcinoma 2 (DIRC2))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DIRC2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DIRC2 anticorps

Épitope: Middle Region

Specificité: DIRC2 antibody was raised against the middle region of DIRC2

Purification: Affinity purified

Immunogène: DIRC2 antibody was raised using the middle region of DIRC2 corresponding to a region with amino acids AAESSRAHIKDRIEAVLYAEFGVVCLIFSATLAYFPPRPPLPPSVAAASQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DIRC2 Blocking Peptide, (ABIN936149), is also available for use as a blocking control in assays to test for specificity of this DIRC2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DIRC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DIRC2

Antigène: DIRC2 (Disrupted in Renal Carcinoma 2 (DIRC2))

Autre désignation: DIRC2

Sujet: DIRC2 is a membrane-bound protein from the major facilitator superfamily of transporters. Disruption of DIRC2 by translocation has been associated with haplo-insufficiency and renal cell carcinomas. Alternatively spliced transcript variants have been described, but their biological validity has not yet been determined.

Poids moléculaire: 52 kDa (MW of target protein)